![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily) membrane-associated alpha-helical protein; no transmembrane helices |
![]() | Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) ![]() location - intermembrane side of the bc1 complex automatically mapped to Pfam PF02320 |
![]() | Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins) "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1 |
![]() | Protein automated matches [190042] (4 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries) |
![]() | Domain d3l75h_: 3l75 H: [180035] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75w_ automated match to d1bcch_ complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75h_ f.28.1.1 (H:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} eeeelvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhc vahklfnklk
Timeline for d3l75h_:
![]() Domains from other chains: (mouse over for more information) d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ |