| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
| Family f.23.11.0: automated matches [232790] (1 protein) not a true family |
| Protein automated matches [232791] (3 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries) |
| Domain d3l75q2: 3l75 Q:196-241 [239405] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ automated match to d3l70d2 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk
Timeline for d3l75q2:
View in 3DDomains from other chains: (mouse over for more information) d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ |