SCOPe 2.08: Domain d3l75d2: 3l75 D:196-241

Lineage for d3l75d2 (3l75 D:196-241)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)

8. Domain d3l75d2: 3l75 D:196-241 [239399]
   Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_
   automated match to d3l70d2
   complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75d2

PDB Entry: 3l75, 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound

PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l75d2:

Sequence; same for both SEQRES and ATOM records:

>d3l75d2 f.23.11.0 (D:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

Timeline for d3l75d2:

• d3l75d2 first appeared in SCOPe 2.04
  
• d3l75d2 appears in SCOPe 2.07