Lineage for d3l75d2 (3l75 D:196-241)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025791Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 3025836Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 3025837Protein automated matches [232791] (3 species)
    not a true protein
  7. 3025842Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)
  8. 3025847Domain d3l75d2: 3l75 D:196-241 [239399]
    Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_
    automated match to d3l70d2
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75d2

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l75d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75d2 f.23.11.0 (D:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

SCOPe Domain Coordinates for d3l75d2:

Click to download the PDB-style file with coordinates for d3l75d2.
(The format of our PDB-style files is described here.)

Timeline for d3l75d2: