SCOPe 2.08: Domain d3l18a1: 3l18 A:1-166

Lineage for d3l18a1 (3l18 A:1-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
   contains a catalytic triad or dyad different from the class I GAT triad

6. Protein automated matches [190995] (8 species)
   not a true protein

7. Species Thermococcus onnurineus [TaxId:523850] [189567] (1 PDB entry)

8. Domain d3l18a1: 3l18 A:1-166 [179851]
   Other proteins in same PDB: d3l18a2, d3l18b2
   automated match to d1g2ia_

Details for d3l18a1

PDB Entry: 3l18, 1.78 Å

PDB Description: Ton1285, an Intracellular Protease from Thermococcus onnurineus NA1

PDB Compounds: (A:) Intracellular protease I

SCOPe Domain Sequences for d3l18a1:

Sequence; same for both SEQRES and ATOM records:

>d3l18a1 c.23.16.2 (A:1-166) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mkvlflsadgfedleliyplhrikeeghevyvasfqrgkitgkhgysvnvdltfeevdpd
efdalvlpggkapeivrlnekavmitrrmfeddkpvasichgpqilisakvlkgrrgtst
itirddvinagaewidaevvvdgnwvssrhpgdlyawmrefvkllh

Timeline for d3l18a1:

• d3l18a1 first appeared in SCOPe 2.01, called d3l18a_
  
• d3l18a1 appears in SCOPe 2.07