Lineage for d3l0ea_ (3l0e A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2013051Domain d3l0ea_: 3l0e A: [179839]
    automated match to d1p8da_
    complexed with g58

Details for d3l0ea_

PDB Entry: 3l0e (more details), 2.3 Å

PDB Description: x-ray crystal structure of a potent liver x receptor modulator
PDB Compounds: (A:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d3l0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0ea_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqsnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetesitflkdftyskd
dfhraglqvefinpifefsramsslglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrladaalppllseiwd
vhe

SCOPe Domain Coordinates for d3l0ea_:

Click to download the PDB-style file with coordinates for d3l0ea_.
(The format of our PDB-style files is described here.)

Timeline for d3l0ea_: