PDB entry 3l0e

View 3l0e on RCSB PDB site
Description: X-ray crystal structure of a Potent Liver X Receptor Modulator
Class: transcription
Keywords: hLXR-beta, human Liver X Receptor-beta, sulfonamide modulator, DNA-binding, Metal-binding, Nucleus, Receptor, Transcription, Transcription regulation, Zinc-finger, Activator, Phosphoprotein
Deposited on 2009-12-09, released 2010-04-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055 (Start-252)
      • engineered (29)
      • engineered (117)
      • engineered (152-153)
      • engineered (236)
      • engineered (238-239)
    Domains in SCOPe 2.06: d3l0ea_
  • Chain 'B':
    Compound: nuclear receptor coactivator 2
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: G58, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3l0eA (A:)
    gshmgegegvqltaaqelmiqqlvaaqlqsnkrsfsdqpkvtpwplgadpqsrdarqqrf
    ahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlletarrynhetesit
    flkdftyskddfhraglqvefinpifefsramsslglddaeyalliainifsadrpnvqe
    pgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrladaa
    lppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3l0eA (A:)
    qltaaqelmiqqlvaaqlqsnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
    vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetesitflkdftyskd
    dfhraglqvefinpifefsramsslglddaeyalliainifsadrpnvqepgrvealqqp
    yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrladaalppllseiwd
    vhe
    

  • Chain 'B':
    No sequence available.