Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (6 species) not a true protein |
Species Streptomyces avermitilis [TaxId:33903] [189136] (1 PDB entry) |
Domain d3kl2l_: 3kl2 L: [179422] automated match to d1j2ra_ complexed with so4 |
PDB Entry: 3kl2 (more details), 2.3 Å
SCOPe Domain Sequences for d3kl2l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kl2l_ c.33.1.0 (L:) automated matches {Streptomyces avermitilis [TaxId: 33903]} eldpartaivlieyqneftsdggvlhgavadvmqhtgmlantvavvdaarqagvpimhap itfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelapvngdiviegkrgldtfas tnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaatsqeehnnais ydfpmfsvpmtsadviaale
Timeline for d3kl2l_: