SCOPe 2.01: Structural Classification of Proteins

PDB entry 3kl2

View 3kl2 on RCSB PDB site
Description: Crystal structure of a putative isochorismatase from Streptomyces avermitilis
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2009-11-06, released 2009-11-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.191
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2a_
Chain 'B':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2b_
Chain 'C':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2c_
Chain 'D':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2d_
Chain 'E':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218-221)
Domains in SCOPe 2.01: d3kl2e_
Chain 'F':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2f_
Chain 'G':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2g_
Chain 'H':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
Domains in SCOPe 2.01: d3kl2h_
Chain 'I':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
Domains in SCOPe 2.01: d3kl2i_
Chain 'J':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
Domains in SCOPe 2.01: d3kl2j_
Chain 'K':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2k_
Chain 'L':
Compound: Putative isochorismatase
Species: Streptomyces avermitilis [TaxId:33903]
Gene: dhbB1, SAV1388, SAV_1388
Database cross-references and differences (RAF-indexed):
- Uniprot Q82NB5 (Start-217)
  - expression tag (218)
Domains in SCOPe 2.01: d3kl2l_
Heterogens: SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3kl2A (A:)
mslttsktrksgvamtekleldpartaivlieyqneftsdggvlhgavadvmqhtgmlan
tvavvdaarqagvpimhapitfaegygeltrhpygilkgvvdgkafvkgtwgaaivdela
pvngdiviegkrgldtfastnldfilrskgvdtivlggfltnccvestmrtgyergfrvi
tltdcvaatsqeehnnaisydfpmfsvpmtsadviaaleghhhhhh