Lineage for d3kl2a_ (3kl2 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 986330Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 986331Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 986365Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 986366Protein automated matches [190499] (6 species)
    not a true protein
  7. 986382Species Streptomyces avermitilis [TaxId:33903] [189136] (1 PDB entry)
  8. 986383Domain d3kl2a_: 3kl2 A: [179411]
    automated match to d1j2ra_
    complexed with so4

Details for d3kl2a_

PDB Entry: 3kl2 (more details), 2.3 Å

PDB Description: crystal structure of a putative isochorismatase from streptomyces avermitilis
PDB Compounds: (A:) Putative isochorismatase

SCOPe Domain Sequences for d3kl2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kl2a_ c.33.1.0 (A:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
ekleldpartaivlieyqneftsdggvlhgavadvmqhtgmlantvavvdaarqagvpim
hapitfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelapvngdiviegkrgldt
fastnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaatsqeehnn
aisydfpmfsvpmtsadviaale

SCOPe Domain Coordinates for d3kl2a_:

Click to download the PDB-style file with coordinates for d3kl2a_.
(The format of our PDB-style files is described here.)

Timeline for d3kl2a_: