Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein Acidic FGF (FGF1) [50357] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries) Uniprot P05230 16-152 ! Uniprot P05230 |
Domain d3jute_: 3jut E: [178841] automated match to d1hkne_ complexed with gtq |
PDB Entry: 3jut (more details), 2.25 Å
SCOPe Domain Sequences for d3jute_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jute_ b.42.1.1 (E:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]} kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk ailflplpvs
Timeline for d3jute_: