Lineage for d3jutb_ (3jut B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791607Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2791608Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2791622Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2791768Domain d3jutb_: 3jut B: [178838]
    automated match to d1hkne_
    complexed with gtq

Details for d3jutb_

PDB Entry: 3jut (more details), 2.25 Å

PDB Description: Acidic Fibroblast Growth Factor (FGF-1) complexed with gentisic acid
PDB Compounds: (B:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3jutb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jutb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
ailflplpvs

SCOPe Domain Coordinates for d3jutb_:

Click to download the PDB-style file with coordinates for d3jutb_.
(The format of our PDB-style files is described here.)

Timeline for d3jutb_: