Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (1 species) not a true protein |
Species Pseudoalteromonas sp. [TaxId:336179] [188943] (1 PDB entry) |
Domain d3hp4a_: 3hp4 A: [177748] automated match to d1ivna_ |
PDB Entry: 3hp4 (more details), 1.35 Å
SCOPe Domain Sequences for d3hp4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hp4a_ c.23.10.0 (A:) automated matches {Pseudoalteromonas sp. [TaxId: 336179]} dntililgdxlsaayglqqeegwvkllqdkydaeqsdivlinasisgetsggalrrldal leqyepthvlielgandglrgfpvkkmqtnltalvkksqaanamtalmeiyippnygpry skmftssftqisedtnahlmnffmldiagksdlmqndslhpnkkaqplirdemydsikkw lnn
Timeline for d3hp4a_: