Lineage for d3hp4a_ (3hp4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857567Species Pseudoalteromonas sp. [TaxId:336179] [188943] (1 PDB entry)
  8. 2857568Domain d3hp4a_: 3hp4 A: [177748]
    automated match to d1ivna_

Details for d3hp4a_

PDB Entry: 3hp4 (more details), 1.35 Å

PDB Description: crystal structure of psychrotrophic esterase esta from pseudoalteromonas sp. 643a inhibited by monoethylphosphonate
PDB Compounds: (A:) GDSL-esterase

SCOPe Domain Sequences for d3hp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hp4a_ c.23.10.0 (A:) automated matches {Pseudoalteromonas sp. [TaxId: 336179]}
dntililgdxlsaayglqqeegwvkllqdkydaeqsdivlinasisgetsggalrrldal
leqyepthvlielgandglrgfpvkkmqtnltalvkksqaanamtalmeiyippnygpry
skmftssftqisedtnahlmnffmldiagksdlmqndslhpnkkaqplirdemydsikkw
lnn

SCOPe Domain Coordinates for d3hp4a_:

Click to download the PDB-style file with coordinates for d3hp4a_.
(The format of our PDB-style files is described here.)

Timeline for d3hp4a_: