Lineage for d1ivna_ (1ivn A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 983275Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 983324Family c.23.10.5: TAP-like [89594] (2 proteins)
  6. 983328Protein Thioesterase I, TAP [89595] (1 species)
    multifunctional enzyme with thioesterase, esterase, protease and lysophospholiase activities
  7. 983329Species Escherichia coli [TaxId:562] [89596] (5 PDB entries)
    Uniprot P29679 27-205
  8. 983331Domain d1ivna_: 1ivn A: [83719]
    complexed with gol, so4

Details for d1ivna_

PDB Entry: 1ivn (more details), 1.9 Å

PDB Description: E.coli Thioesterase I/Protease I/Lysophospholiase L1
PDB Compounds: (A:) Thioesterase I

SCOPe Domain Sequences for d1ivna_:

Sequence, based on SEQRES records: (download)

>d1ivna_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrrynea
fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh

Sequence, based on observed residues (ATOM records): (download)

>d1ivna_ c.23.10.5 (A:) Thioesterase I, TAP {Escherichia coli [TaxId: 562]}
adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh

SCOPe Domain Coordinates for d1ivna_:

Click to download the PDB-style file with coordinates for d1ivna_.
(The format of our PDB-style files is described here.)

Timeline for d1ivna_: