Lineage for d1glqa1 (1glq A:79-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999147Protein Class pi GST [81347] (4 species)
  7. 1999289Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)
  8. 1999290Domain d1glqa1: 1glq A:79-209 [17588]
    Other proteins in same PDB: d1glqa2, d1glqb2
    complexed with gtb

Details for d1glqa1

PDB Entry: 1glq (more details), 1.8 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors
PDB Compounds: (A:) glutathione s-transferase yfyf

SCOPe Domain Sequences for d1glqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glqa1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOPe Domain Coordinates for d1glqa1:

Click to download the PDB-style file with coordinates for d1glqa1.
(The format of our PDB-style files is described here.)

Timeline for d1glqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glqa2