Lineage for d1glqa1 (1glq A:79-209)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3697Protein Glutathione S-transferase [47618] (22 species)
  7. 3866Species Mouse (Mus musculus), class pi [TaxId:10090] [47621] (6 PDB entries)
  8. 3867Domain d1glqa1: 1glq A:79-209 [17588]
    Other proteins in same PDB: d1glqa2, d1glqb2

Details for d1glqa1

PDB Entry: 1glq (more details), 1.8 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

SCOP Domain Sequences for d1glqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glqa1 a.45.1.1 (A:79-209) Glutathione S-transferase {Mouse (Mus musculus), class pi}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

SCOP Domain Coordinates for d1glqa1:

Click to download the PDB-style file with coordinates for d1glqa1.
(The format of our PDB-style files is described here.)

Timeline for d1glqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glqa2