SCOPe 2.08: Domain d1glqa1: 1glq A:79-209

Lineage for d1glqa1 (1glq A:79-209)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (10 PDB entries)

8. Domain d1glqa1: 1glq A:79-209 [17588]
   Other proteins in same PDB: d1glqa2, d1glqb2
   complexed with gtb

Details for d1glqa1

PDB Entry: 1glq, 1.8 Å

PDB Description: 1.8 angstroms molecular structure of mouse liver class pi glutathione s-transferase complexed with s-(p-nitrobenzyl)glutathione and other inhibitors

PDB Compounds: (A:) glutathione s-transferase yfyf

SCOPe Domain Sequences for d1glqa1:

Sequence; same for both SEQRES and ATOM records:

>d1glqa1 a.45.1.1 (A:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d1glqa1:

• d1glqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1glqa1 appears in SCOPe 2.07