SCOPe 2.08: Domain d3faud1: 3fau D:11-90

Lineage for d3faud1 (3fau D:11-90)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.8: SMR domain-like [160443] (1 family)
   automatically mapped to Pfam PF01713

5. Family d.68.8.1: Smr domain [160444] (2 proteins)
   Pfam PF01713

6. Protein automated matches [191106] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry)

8. Domain d3faud1: 3fau D:11-90 [175625]
   Other proteins in same PDB: d3faua2, d3faub2, d3fauc2, d3faud2
   automated match to d2d9ia1

Details for d3faud1

PDB Entry: 3fau, 1.9 Å

PDB Description: crystal structure of human small-muts related domain

PDB Compounds: (D:) NEDD4-binding protein 2

SCOPe Domain Sequences for d3faud1:

Sequence, based on SEQRES records:

>d3faud1 d.68.8.1 (D:11-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavikyl
ishsfrfseikpgclkvmlk

Sequence, based on observed residues (ATOM records):

>d3faud1 d.68.8.1 (D:11-90) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgsqggvarikpavikylis
hsfrfseikpgclkvmlk

Timeline for d3faud1:

• d3faud1 first appeared in SCOPe 2.01, called d3faud_
  
• d3faud1 appears in SCOPe 2.07