Lineage for d3faua1 (3fau A:11-89)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957505Superfamily d.68.8: SMR domain-like [160443] (1 family) (S)
    automatically mapped to Pfam PF01713
  5. 2957506Family d.68.8.1: Smr domain [160444] (2 proteins)
    Pfam PF01713
  6. 2957510Protein automated matches [191106] (1 species)
    not a true protein
  7. 2957511Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry)
  8. 2957512Domain d3faua1: 3fau A:11-89 [175622]
    Other proteins in same PDB: d3faua2, d3faub2, d3fauc2, d3faud2
    automated match to d2d9ia1

Details for d3faua1

PDB Entry: 3fau (more details), 1.9 Å

PDB Description: crystal structure of human small-muts related domain
PDB Compounds: (A:) NEDD4-binding protein 2

SCOPe Domain Sequences for d3faua1:

Sequence, based on SEQRES records: (download)

>d3faua1 d.68.8.1 (A:11-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpavikyl
ishsfrfseikpgclkvml

Sequence, based on observed residues (ATOM records): (download)

>d3faua1 d.68.8.1 (A:11-89) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrrikpavikylishsfrfse
ikpgclkvml

SCOPe Domain Coordinates for d3faua1:

Click to download the PDB-style file with coordinates for d3faua1.
(The format of our PDB-style files is described here.)

Timeline for d3faua1: