SCOPe 2.01: Domain d3faua_: 3fau A:

Lineage for d3faua_ (3fau A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.8: SMR domain-like [160443] (1 family)

5. Family d.68.8.1: Smr domain [160444] (2 proteins)
   Pfam PF01713

6. Protein automated matches [191106] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry)

8. Domain d3faua_: 3fau A: [175622]
   automated match to d2d9ia1

Details for d3faua_

PDB Entry: 3fau, 1.9 Å

PDB Description: crystal structure of human small-muts related domain

PDB Compounds: (A:) NEDD4-binding protein 2

SCOPe Domain Sequences for d3faua_:

Sequence, based on SEQRES records:

>d3faua_ d.68.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpaviky
lishsfrfseikpgclkvml

Sequence, based on observed residues (ATOM records):

>d3faua_ d.68.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrrikpavikylishsfrfs
eikpgclkvml

Timeline for d3faua_:

• d3faua_ is new in SCOPe 2.01-stable
  
• d3faua_ appears in SCOPe 2.02
  
• d3faua_ appears in the current release, SCOPe 2.08, called d3faua1