Lineage for d3faud_ (3fau D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1031026Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1031280Superfamily d.68.8: SMR domain-like [160443] (1 family) (S)
  5. 1031281Family d.68.8.1: Smr domain [160444] (2 proteins)
    Pfam PF01713
  6. 1031285Protein automated matches [191106] (1 species)
    not a true protein
  7. 1031286Species Human (Homo sapiens) [TaxId:9606] [189140] (1 PDB entry)
  8. 1031290Domain d3faud_: 3fau D: [175625]
    automated match to d2d9ia1

Details for d3faud_

PDB Entry: 3fau (more details), 1.9 Å

PDB Description: crystal structure of human small-muts related domain
PDB Compounds: (D:) NEDD4-binding protein 2

SCOPe Domain Sequences for d3faud_:

Sequence, based on SEQRES records: (download)

>d3faud_ d.68.8.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgnhsqggvarikpaviky
lishsfrfseikpgclkvmlk

Sequence, based on observed residues (ATOM records): (download)

>d3faud_ d.68.8.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sldlhglhvdealehlmrvlekkteefkqnggkpylsvitgrgsqggvarikpavikyli
shsfrfseikpgclkvmlk

SCOPe Domain Coordinates for d3faud_:

Click to download the PDB-style file with coordinates for d3faud_.
(The format of our PDB-style files is described here.)

Timeline for d3faud_: