Lineage for d3dxkg_ (3dxk G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922841Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
  5. 922842Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 922848Protein automated matches [190348] (1 species)
    not a true protein
  7. 922849Species Cow (Bos taurus) [TaxId:9913] [187175] (10 PDB entries)
  8. 922855Domain d3dxkg_: 3dxk G: [174330]
    Other proteins in same PDB: d3dxkc_, d3dxke_, d3dxkf_
    automated match to d1k8kg_
    complexed with n23

Details for d3dxkg_

PDB Entry: 3dxk (more details), 2.7 Å

PDB Description: Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d3dxkg_:

Sequence, based on SEQRES records: (download)

>d3dxkg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d3dxkg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdgpdegevdsclrqgnmtaalqaalknppintksqavkdrags
ivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaagg
vgsivrvltarktv

SCOPe Domain Coordinates for d3dxkg_:

Click to download the PDB-style file with coordinates for d3dxkg_.
(The format of our PDB-style files is described here.)

Timeline for d3dxkg_: