![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) ![]() |
![]() | Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins) |
![]() | Protein automated matches [190348] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187175] (10 PDB entries) |
![]() | Domain d3dxkg_: 3dxk G: [174330] Other proteins in same PDB: d3dxkc_, d3dxke_, d3dxkf_ automated match to d1k8kg_ complexed with n23 |
PDB Entry: 3dxk (more details), 2.7 Å
SCOPe Domain Sequences for d3dxkg_:
Sequence, based on SEQRES records: (download)
>d3dxkg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw hekalaaggvgsivrvltarktv
>d3dxkg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} arfrkvdvgeydenkfvdgpdegevdsclrqgnmtaalqaalknppintksqavkdrags ivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaagg vgsivrvltarktv
Timeline for d3dxkg_: