![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (3 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.1: WD40-repeat [50979] (11 proteins) this is a repeat family; one repeat unit is 1tyq C:201-243 found in domain |
![]() | Protein automated matches [190346] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187173] (10 PDB entries) |
![]() | Domain d3dxkc_: 3dxk C: [174327] Other proteins in same PDB: d3dxke_, d3dxkf_, d3dxkg_ automated match to d1tyqc_ complexed with n23 |
PDB Entry: 3dxk (more details), 2.7 Å
SCOPe Domain Sequences for d3dxkc_:
Sequence, based on SEQRES records: (download)
>d3dxkc_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidwa pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltarer fqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvrs lesalkdlkiv
>d3dxkc_ b.69.4.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]} ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgidwa pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa ptpwgskmpfgelmfesscgwvhgvcfsangsrvawvshdstvcladadkkmavatlase tlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsqis vlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
Timeline for d3dxkc_: