Lineage for d3dxkf_ (3dxk F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1050398Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1050472Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1050473Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1050496Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1050497Species Cow (Bos taurus) [TaxId:9913] [69648] (13 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1050506Domain d3dxkf_: 3dxk F: [174329]
    Other proteins in same PDB: d3dxkc_, d3dxke_, d3dxkg_
    automated match to d1k8kf_
    complexed with n23

Details for d3dxkf_

PDB Entry: 3dxk (more details), 2.7 Å

PDB Description: Structure of Bos Taurus Arp2/3 Complex with Bound Inhibitor CK0944636
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d3dxkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxkf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d3dxkf_:

Click to download the PDB-style file with coordinates for d3dxkf_.
(The format of our PDB-style files is described here.)

Timeline for d3dxkf_: