Lineage for d1b47a1 (1b47 A:178-263)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1997536Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (9 proteins)
  6. 1997540Protein Cbl [47561] (1 species)
  7. 1997541Species Human (Homo sapiens) [TaxId:9606] [47562] (11 PDB entries)
  8. 1997550Domain d1b47a1: 1b47 A:178-263 [17381]
    Other proteins in same PDB: d1b47a2, d1b47a3, d1b47b2, d1b47b3, d1b47c2, d1b47c3
    complexed with ca

Details for d1b47a1

PDB Entry: 1b47 (more details), 2.2 Å

PDB Description: structure of the n-terminal domain of cbl in complex with its binding site in zap-70
PDB Compounds: (A:) cbl

SCOPe Domain Sequences for d1b47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b47a1 a.39.1.7 (A:178-263) Cbl {Human (Homo sapiens) [TaxId: 9606]}
tfritkadaaefwrkafgektivpwksfrqalhevhpissgleamalkstidltcndyis
vfefdiftrlfqpwssllrnwnslav

SCOPe Domain Coordinates for d1b47a1:

Click to download the PDB-style file with coordinates for d1b47a1.
(The format of our PDB-style files is described here.)

Timeline for d1b47a1: