Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Cbl [55587] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55588] (11 PDB entries) |
Domain d1b47a3: 1b47 A:264-350 [40529] Other proteins in same PDB: d1b47a1, d1b47a2, d1b47b1, d1b47b2, d1b47c1, d1b47c2 complexed with ca |
PDB Entry: 1b47 (more details), 2.2 Å
SCOPe Domain Sequences for d1b47a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b47a3 d.93.1.1 (A:264-350) Cbl {Human (Homo sapiens) [TaxId: 9606]} thpgymafltydevkarlqkfihkpgsyifrlsctrlgqwaigyvtadgnilqtiphnkp lfqalidgfregfylfpdgrnqnpdlt
Timeline for d1b47a3: