Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (8 species) not a true protein |
Species Mesorhizobium loti [TaxId:381] [188511] (2 PDB entries) |
Domain d3co2d_: 3co2 D: [173366] automated match to d1vp6a_ mutant |
PDB Entry: 3co2 (more details), 2.9 Å
SCOPe Domain Sequences for d3co2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3co2d_ b.82.3.2 (D:) automated matches {Mesorhizobium loti [TaxId: 381]} rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg svsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspeia eifrktale
Timeline for d3co2d_: