SCOPe 2.06: Domain d3co2a_: 3co2 A:

Lineage for d3co2a_ (3co2 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:381] [188511] (2 PDB entries)

8. Domain d3co2a_: 3co2 A: [173363]
   automated match to d1vp6a_
   mutant

Details for d3co2a_

PDB Entry: 3co2, 2.9 Å

PDB Description: mlotik1 ion channel cyclic-nucleotide binding domain mutant

PDB Compounds: (A:) Mlotik1 ion channel protein

SCOPe Domain Sequences for d3co2a_:

Sequence; same for both SEQRES and ATOM records:

>d3co2a_ b.82.3.2 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}
gdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvvegsv
svatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspeiaei
frktal

Timeline for d3co2a_:

• d3co2a_ first appeared in SCOPe 2.01
  
• d3co2a_ appears in SCOPe 2.05
  
• d3co2a_ appears in SCOPe 2.07
  
• d3co2a_ appears in the current release, SCOPe 2.08