PDB entry 3co2

View 3co2 on RCSB PDB site
Description: Mlotik1 ion channel cyclic-nucleotide binding domain mutant
Class: membrane protein
Keywords: Mlotik1 cyclic-nucleotide binding domain mutant3 R307W, unliganded, MEMBRANE PROTEIN
Deposited on 2008-03-27, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.263
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mlotik1 ion channel protein
    Species: Mesorhizobium loti
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (91)
    Domains in SCOPe 2.06: d3co2a_
  • Chain 'B':
    Compound: Mlotik1 ion channel protein
    Species: Mesorhizobium loti
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (91)
    Domains in SCOPe 2.06: d3co2b_
  • Chain 'C':
    Compound: Mlotik1 ion channel protein
    Species: Mesorhizobium loti
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (91)
    Domains in SCOPe 2.06: d3co2c_
  • Chain 'D':
    Compound: Mlotik1 ion channel protein
    Species: Mesorhizobium loti
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q98GN8
      • engineered (91)
    Domains in SCOPe 2.06: d3co2d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3co2A (A:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3co2A (A:)
    gdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvvegsv
    svatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspeiaei
    frktal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3co2B (B:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3co2B (B:)
    rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
    svsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspeia
    eifrktal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3co2C (C:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3co2C (C:)
    rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
    svsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3co2D (D:)
    qevrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffv
    vegsvsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcsssp
    eiaeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3co2D (D:)
    rrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvveg
    svsvatpnpvelgpgaffgemalisgepwsatvsaattvsllslhsadfqmlcssspeia
    eifrktale