SCOPe 2.01: Domain d2wdzd_: 2wdz D:

Lineage for d2wdzd_ (2wdz D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (51 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [189314] (2 PDB entries)

8. Domain d2wdzd_: 2wdz D: [169262]
   automated match to d1vl8b_
   complexed with 1sp, mg, nad

Details for d2wdzd_

PDB Entry: 2wdz, 1.95 Å

PDB Description: crystal structure of the short chain dehydrogenase galactitol-dehydrogenase (gatdh) of rhodobacter sphaeroides in complex with nad+ and 1,2-pentandiol

PDB Compounds: (D:) short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d2wdzd_:

Sequence; same for both SEQRES and ATOM records:

>d2wdzd_ c.2.1.0 (D:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava
arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm
fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr
gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv
tgailavdggytvw

Timeline for d2wdzd_:

• d2wdzd_ is new in SCOPe 2.01-stable
  
• d2wdzd_ appears in SCOPe 2.02
  
• d2wdzd_ appears in the current release, SCOPe 2.08