Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (51 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [189314] (2 PDB entries) |
Domain d2wdzc_: 2wdz C: [169261] automated match to d1vl8b_ complexed with 1sp, mg, nad |
PDB Entry: 2wdz (more details), 1.95 Å
SCOPe Domain Sequences for d2wdzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wdzc_ c.2.1.0 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv tgailavdggytvw
Timeline for d2wdzc_: