Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries) |
Domain d2vdii_: 2vdi I: [168472] automated match to d2v63i1 complexed with cap, edo, mg; mutant |
PDB Entry: 2vdi (more details), 2.65 Å
SCOPe Domain Sequences for d2vdii_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdii_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpktardfqpankrsv
Timeline for d2vdii_: