Lineage for d2vdik_ (2vdi K:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208801Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1208802Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1208803Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1208804Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1208823Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69758] (6 PDB entries)
  8. 1208854Domain d2vdik_: 2vdi K: [168474]
    automated match to d2v63i1
    complexed with cap, edo, mg; mutant

Details for d2vdik_

PDB Entry: 2vdi (more details), 2.65 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit c192s mutation
PDB Compounds: (K:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2vdik_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdik_ d.73.1.1 (K:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2vdik_:

Click to download the PDB-style file with coordinates for d2vdik_.
(The format of our PDB-style files is described here.)

Timeline for d2vdik_: