Lineage for d2p3db_ (2p3d B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2068913Protein automated matches [190433] (11 species)
    not a true protein
  7. 2068957Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)
  8. 2069015Domain d2p3db_: 2p3d B: [166996]
    automated match to d1a8ga_
    complexed with 3tl; mutant

Details for d2p3db_

PDB Entry: 2p3d (more details), 2.8 Å

PDB Description: crystal structure of the multi-drug resistant mutant subtype f hiv protease complexed with tl-3 inhibitor
PDB Compounds: (B:) pol protein

SCOPe Domain Sequences for d2p3db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3db_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrpivtikvegqlrealldtgaddtvledinlsgkwkpkiiggirgfvkvkqye
dilieicghravgavlvgptpaniigrnmltqigctlnf

SCOPe Domain Coordinates for d2p3db_:

Click to download the PDB-style file with coordinates for d2p3db_.
(The format of our PDB-style files is described here.)

Timeline for d2p3db_: