SCOPe 2.06: Domain d2p3da_: 2p3d A:

Lineage for d2p3da_ (2p3d A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (25 PDB entries)

8. Domain d2p3da_: 2p3d A: [166995]
   automated match to d1a8ga_
   complexed with 3tl; mutant

Details for d2p3da_

PDB Entry: 2p3d, 2.8 Å

PDB Description: crystal structure of the multi-drug resistant mutant subtype f hiv protease complexed with tl-3 inhibitor

PDB Compounds: (A:) pol protein

SCOPe Domain Sequences for d2p3da_:

Sequence; same for both SEQRES and ATOM records:

>d2p3da_ b.50.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrpivtikvegqlrealldtgaddtvledinlsgkwkpkiiggirgfvkvkqye
dilieicghravgavlvgptpaniigrnmltqigctlnf

Timeline for d2p3da_:

• d2p3da_ first appeared in SCOPe 2.01
  
• d2p3da_ appears in SCOPe 2.05
  
• d2p3da_ appears in SCOPe 2.07
  
• d2p3da_ appears in the current release, SCOPe 2.08