Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries) |
Domain d2oxhc_: 2oxh C: [166907] automated match to d1v8ha1 complexed with edo |
PDB Entry: 2oxh (more details), 2.35 Å
SCOPe Domain Sequences for d2oxhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oxhc_ b.1.18.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]} addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
Timeline for d2oxhc_: