Lineage for d2oxhz_ (2oxh Z:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039765Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries)
  8. 2039777Domain d2oxhz_: 2oxh Z: [166909]
    automated match to d1v8ha1
    complexed with edo

Details for d2oxhz_

PDB Entry: 2oxh (more details), 2.35 Å

PDB Description: The SOXYZ Complex of Paracoccus Pantotrophus
PDB Compounds: (Z:) SoxZ protein

SCOPe Domain Sequences for d2oxhz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxhz_ b.1.18.0 (Z:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav

SCOPe Domain Coordinates for d2oxhz_:

Click to download the PDB-style file with coordinates for d2oxhz_.
(The format of our PDB-style files is described here.)

Timeline for d2oxhz_: