PDB entry 2oxh

View 2oxh on RCSB PDB site
Description: The SOXYZ Complex of Paracoccus Pantotrophus
Class: transport protein
Keywords: immunoglobulin-like beta-sandwich fold, transport protein
Deposited on 2007-02-20, released 2007-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oxha_
  • Chain 'B':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (11-123)
      • expression tag (9)
      • cloning artifact (10-11)
      • modified residue (121)
  • Chain 'C':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oxhc_
  • Chain 'D':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9
      • modified residue (121)
  • Chain 'E':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oxhe_
  • Chain 'F':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (11-123)
      • cloning artifact (10-11)
      • modified residue (121)
  • Chain 'Y':
    Compound: SoxY protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxY
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LCU9 (11-End)
      • cloning artifact (11)
      • modified residue (121)
  • Chain 'Z':
    Compound: SoxZ protein
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: soxZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2oxhz_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxhA (A:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxhC (C:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxhE (E:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
    

  • Chain 'F':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2oxhZ (Z:)
    addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
    vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav