Lineage for d1qkra_ (1qkr A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083641Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 1083642Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 1083658Protein Vinculin [47224] (2 species)
  7. 1083659Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
    Uniprot P12003
  8. 1083660Domain d1qkra_: 1qkr A: [16628]
    tail domain
    complexed with so4

Details for d1qkra_

PDB Entry: 1qkr (more details), 1.8 Å

PDB Description: crystal structure of the vinculin tail and a pathway for activation
PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1qkra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkra_ a.24.9.1 (A:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
kdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrgg
sgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilst
vkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvr
k

SCOPe Domain Coordinates for d1qkra_:

Click to download the PDB-style file with coordinates for d1qkra_.
(The format of our PDB-style files is described here.)

Timeline for d1qkra_: