Lineage for d1qkra_ (1qkr A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) 
Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) 
Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) 
Protein Vinculin, tail domain [47224] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [47225] (1 PDB entry) 
Domain d1qkra_: 1qkr A: [16628]
Details for d1qkra_
PDB Entry: 1qkr (more details), 1.8 Å
PDB Description: crystal structure of the vinculin tail and a pathway for activation
SCOP Domain Sequences for d1qkra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qkra_ a.24.9.1 (A:) Vinculin, tail domain {Chicken (Gallus gallus)}
kdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrgg
sgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilst
vkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvr
k
SCOP Domain Coordinates for d1qkra_:
Click to download the PDB-style file with coordinates for d1qkra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qkra_:
- d1qkra_ appears in SCOP 1.57
- d1qkra_ appears in the current release, SCOPe 2.08
View in 3D
