SCOPe 2.03: Domain d1qkra_: 1qkr A:

Lineage for d1qkra_ (1qkr A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47225] (3 PDB entries)
   Uniprot P12003

8. Domain d1qkra_: 1qkr A: [16628]
   tail domain
   complexed with so4

Details for d1qkra_

PDB Entry: 1qkr, 1.8 Å

PDB Description: crystal structure of the vinculin tail and a pathway for activation

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d1qkra_:

Sequence; same for both SEQRES and ATOM records:

>d1qkra_ a.24.9.1 (A:) Vinculin {Chicken (Gallus gallus) [TaxId: 9031]}
kdeefpeqkageainqpmmmaarqlhdearkwsskgndiiaaakrmallmaemsrlvrgg
sgnkraliqcakdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilst
vkatmlgrtnisdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvr
k

Timeline for d1qkra_:

• d1qkra_ first appeared (with stable ids) in SCOP 1.55
  
• d1qkra_ appears in SCOPe 2.02
  
• d1qkra_ appears in SCOPe 2.04
  
• d1qkra_ appears in the current release, SCOPe 2.08