![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.8: Proteasome activator [47216] (1 family) ![]() |
![]() | Family a.24.8.1: Proteasome activator [47217] (3 proteins) |
![]() | Protein Proteasome activator reg(alpha) [47218] (1 species) The structure of the proteasome complex with this protein from (Trypanosoma brucei) is available (1fnt); however, PDB entry 1FNT designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; the proteasome activator pa26 chains are designated by lower case letters (c;d;e;f;g;h;i;j;k;l;m;n;o;p) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47219] (1 PDB entry) |
![]() | Domain d1avo.6: 1avo K:,L: [16624] |
PDB Entry: 1avo (more details), 2.8 Å
SCOPe Domain Sequences for d1avo.6:
Sequence; same for both SEQRES and ATOM records: (download)
>g1avo.6 a.24.8.1 (K:,L:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]} lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi Xavncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmt slhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirn ayavlydiilknfeklkkprg
Timeline for d1avo.6: