Lineage for d1avo.6 (1avo K:,L:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2246Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies)
  4. 2399Superfamily a.24.8: Proteasome activator reg(alpha) [47216] (1 family) (S)
  5. 2400Family a.24.8.1: Proteasome activator reg(alpha) [47217] (1 protein)
  6. 2401Protein Proteasome activator reg(alpha) [47218] (1 species)
  7. 2402Species Human (Homo sapiens) [TaxId:9606] [47219] (1 PDB entry)
  8. 2408Domain d1avo.6: 1avo K:,L: [16624]

Details for d1avo.6

PDB Entry: 1avo (more details), 2.8 Å

PDB Description: proteasome activator reg(alpha)

SCOP Domain Sequences for d1avo.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1avo.6 a.24.8.1 (K:,L:) Proteasome activator reg(alpha) {Human (Homo sapiens)}
lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
Xavncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmt
slhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirn
ayavlydiilknfeklkkprg

SCOP Domain Coordinates for d1avo.6:

Click to download the PDB-style file with coordinates for d1avo.6.
(The format of our PDB-style files is described here.)

Timeline for d1avo.6: