Lineage for d1avo.6 (1avo K:,L:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765527Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 765528Family a.24.8.1: Proteasome activator [47217] (2 proteins)
  6. 765552Protein Proteasome activator reg(alpha) [47218] (1 species)
    The structure of the proteasome complex with this protein from (Trypanosoma brucei) is available (1fnt); however, PDB entry 1FNT designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; the proteasome activator pa26 chains are designated by lower case letters (c;d;e;f;g;h;i;j;k;l;m;n;o;p)
    The structure of the proteasome complex with this protein from (Trypanosoma brucei) is available (1fnt); however, PDB entry 1FNT designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; the proteasome activator pa26 chains are designated by lower case letters (c;d;e;f;g;h;i;j;k;l;m;n;o;p)
  7. 765553Species Human (Homo sapiens) [TaxId:9606] [47219] (1 PDB entry)
  8. 765559Domain d1avo.6: 1avo K:,L: [16624]

Details for d1avo.6

PDB Entry: 1avo (more details), 2.8 Å

PDB Description: proteasome activator reg(alpha)
PDB Compounds: (K:) 11s regulator, (L:) 11s regulator

SCOP Domain Sequences for d1avo.6:

Sequence; same for both SEQRES and ATOM records: (download)

>g1avo.6 a.24.8.1 (K:,L:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]}
lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi
Xavncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmt
slhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirn
ayavlydiilknfeklkkprg

SCOP Domain Coordinates for d1avo.6:

Click to download the PDB-style file with coordinates for d1avo.6.
(The format of our PDB-style files is described here.)

Timeline for d1avo.6: