Class a: All alpha proteins [46456] (284 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.8: Proteasome activator [47216] (1 family) |
Family a.24.8.1: Proteasome activator [47217] (2 proteins) |
Protein Proteasome activator reg(alpha) [47218] (1 species) The structure of the proteasome complex with this protein from (Trypanosoma brucei) is available (1fnt); however, PDB entry 1FNT designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; the proteasome activator pa26 chains are designated by lower case letters (c;d;e;f;g;h;i;j;k;l;m;n;o;p) The structure of the proteasome complex with this protein from (Trypanosoma brucei) is available (1fnt); however, PDB entry 1FNT designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; the proteasome activator pa26 chains are designated by lower case letters (c;d;e;f;g;h;i;j;k;l;m;n;o;p) |
Species Human (Homo sapiens) [TaxId:9606] [47219] (1 PDB entry) |
Domain d1avo.1: 1avo A:,B: [16619] |
PDB Entry: 1avo (more details), 2.8 Å
SCOP Domain Sequences for d1avo.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1avo.1 a.24.8.1 (A:,B:) Proteasome activator reg(alpha) {Human (Homo sapiens) [TaxId: 9606]} lrvqpeaqakvdvfredlctktenllgsyfpkkiseldaflkepalneanlsnlkapldi Xavncnekivvllqrlkpeikdvieqlnlvttwlqlqipriedgnnfgvavqekvfelmt slhtklegfhtqiskyfsergdavtkaakqphvgdyrqlvheldeaeyrdirlmvmeirn ayavlydiilknfeklkkprg
Timeline for d1avo.1: