Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (7 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry) |
Domain d2iglb_: 2igl B: [165541] automated match to d1tfpa_ |
PDB Entry: 2igl (more details), 1.8 Å
SCOPe Domain Sequences for d2iglb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iglb_ b.3.4.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} hmaqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtat tgdyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs
Timeline for d2iglb_: