SCOPe 2.04: Domain d2iglb_: 2igl B:

Lineage for d2iglb_ (2igl B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (7 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry)

8. Domain d2iglb_: 2igl B: [165541]
   automated match to d1tfpa_

Details for d2iglb_

PDB Entry: 2igl, 1.8 Å

PDB Description: Crystal Structure of E. coli YEDX, a transthyretin related protein

PDB Compounds: (B:) transthyretin-like protein

SCOPe Domain Sequences for d2iglb_:

Sequence; same for both SEQRES and ATOM records:

>d2iglb_ b.3.4.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hmaqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtat
tgdyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

Timeline for d2iglb_:

• d2iglb_ first appeared in SCOPe 2.01
  
• d2iglb_ appears in SCOPe 2.03
  
• d2iglb_ appears in SCOPe 2.05
  
• d2iglb_ appears in the current release, SCOPe 2.08, called d2iglb1