Lineage for d2igld_ (2igl D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1773528Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1773529Protein automated matches [190651] (7 species)
    not a true protein
  7. 1773540Species Escherichia coli K-12 [TaxId:83333] [188214] (1 PDB entry)
  8. 1773544Domain d2igld_: 2igl D: [165543]
    automated match to d1tfpa_

Details for d2igld_

PDB Entry: 2igl (more details), 1.8 Å

PDB Description: Crystal Structure of E. coli YEDX, a transthyretin related protein
PDB Compounds: (D:) transthyretin-like protein

SCOPe Domain Sequences for d2igld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igld_ b.3.4.0 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
hmaqqnilsvhilnqqtgkpaadvtvtlekkadngwlqlntaktdkdgrikalwpeqtat
tgdyrvvfktgdyfkkqnlesffpeipvefhinkvnehyhvplllsqygystyrgs

SCOPe Domain Coordinates for d2igld_:

Click to download the PDB-style file with coordinates for d2igld_.
(The format of our PDB-style files is described here.)

Timeline for d2igld_: