SCOPe 2.05: Domain d2hsab_: 2hsa B:

Lineage for d2hsab_ (2hsa B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein automated matches [190228] (15 species)
   not a true protein

7. Species Solanum lycopersicum [TaxId:4081] [187823] (5 PDB entries)

8. Domain d2hsab_: 2hsa B: [165235]
   automated match to d1q45a_
   complexed with cl, fmn, so4

Details for d2hsab_

PDB Entry: 2hsa, 1.5 Å

PDB Description: Crystal structure of 12-oxophytodienoate reductase 3 (OPR3) from tomato

PDB Compounds: (B:) 12-oxophytodienoate reductase 3

SCOPe Domain Sequences for d2hsab_:

Sequence; same for both SEQRES and ATOM records:

>d2hsab_ c.1.4.1 (B:) automated matches {Solanum lycopersicum [TaxId: 4081]}
plfspykmgkfnlshrvvlapmtrcralnnipqaalgeyyeqrataggflitegtmispt
sagfphvpgiftkeqvrewkkivdvvhakgavifcqlwhvgrashevyqpagaapisste
kpisnrwrilmpdgthgiypkpraigtyeisqvvedyrrsalnaieagfdgieihgahgy
lidqflkdgindrtdeyggslanrckfitqvvqavvsaigadrvgvrvspaidhldamds
nplslglavverlnkiqlhsgsklaylhvtqpryvaygqteagrlgseeeearlmrtlrn
ayqgtficsggytrelgieavaqgdadlvsygrlfisnpdlvmriklnaplnkynrktfy
tqdpvvgytdypfl

Timeline for d2hsab_:

• d2hsab_ first appeared in SCOPe 2.01
  
• d2hsab_ appears in SCOPe 2.04
  
• d2hsab_ appears in SCOPe 2.06
  
• d2hsab_ appears in the current release, SCOPe 2.08