SCOPe 2.05: Domain d2dpfb_: 2dpf B:

Lineage for d2dpfb_ (2dpf B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.0: automated matches [191418] (1 protein)
   not a true family

6. Protein automated matches [190587] (7 species)
   not a true protein

7. Species Curculigo latifolia [TaxId:4676] [187595] (2 PDB entries)

8. Domain d2dpfb_: 2dpf B: [163650]
   automated match to d1npla_
   complexed with so4

Details for d2dpfb_

PDB Entry: 2dpf, 1.5 Å

PDB Description: Crystal Structure of curculin1 homodimer

PDB Compounds: (B:) Curculin

SCOPe Domain Sequences for d2dpfb_:

Sequence; same for both SEQRES and ATOM records:

>d2dpfb_ b.78.1.0 (B:) automated matches {Curculigo latifolia [TaxId: 4676]}
dnvllsgqtlhadhslqagaytltiqnkcnlvkyqngrqiwasntdrrgsgcrltllsdg
nlviydhnnndvwgsacwgdngkyalvlqkdgrfviygpvlwslgpngcrr

Timeline for d2dpfb_:

• d2dpfb_ first appeared in SCOPe 2.01
  
• d2dpfb_ appears in SCOPe 2.04
  
• d2dpfb_ appears in SCOPe 2.06
  
• d2dpfb_ appears in the current release, SCOPe 2.08